PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015892878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 704aa    MW: 76913 Da    PI: 5.9168
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015892878.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.74.7e-27212265155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv+av+qL   ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  XP_015892878.1 212 KPRVVWSVELHQKFVSAVKQL-DLEKAVPKKILDLMNVEGLTRENVASHLQKYRL 265
                     79*******************.9*******************************8 PP

2Response_reg83.37.5e-28261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + +  G
  XP_015892878.1  26 VLAVDDDPICLKVLENLLRKCQY-HVTTTNQAIEALKMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKGIIHG 118
                     799********************.***************999889*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  XP_015892878.1 119 ACDYLLKPVRIEELKN 134
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-1671704IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23007.8E-4423165No hitNo description
SuperFamilySSF521726.83E-3723148IPR011006CheY-like superfamily
SMARTSM004485.8E-3424136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.67725140IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.7E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.93E-2927140No hitNo description
SuperFamilySSF466896.99E-19209269IPR009057Homeodomain-like
PROSITE profilePS5129410.656209268IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-29210270IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-24212265IPR006447Myb domain, plants
PfamPF002491.1E-6214264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MTVEGQRGGF VVEDGATDRF PVGMRVLAVD DDPICLKVLE NLLRKCQYHV TTTNQAIEAL  60
KMLRENRNKY DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMKGIIHGAC  120
DYLLKPVRIE ELKNIWQHVI RRRKSNAKDQ NRPPSLNKTS HGTEARKAVA TTGNSDEDGK  180
LSRKRRDQNE DEEEYGEDDE YENEDDPATP KKPRVVWSVE LHQKFVSAVK QLDLEKAVPK  240
KILDLMNVEG LTRENVASHL QKYRLYLKRI STVATQQPSM AAALGVKDST YLHMCSLDGF  300
GDLHAYTGSG RVASTALMPY SPGGMLGRLN SPAGLNLGGI ASSGLVQPGH PQNFSNSFNS  360
LGKLQQSVPA SQTSNLFQRI PTSLELNQLQ QNKCTAHIGG FNPINNPTGF TLPTNYPDTR  420
VNVGSSSNSL SSTSSNHLIL QGSTQSMLSR VASGNHGLAS SNPESFDLGI SGSSNSLNHN  480
PCSERWQGAV KLSKFQSNAL PMSGSFDHGG LHSSNLGISS SSPQIGNNPH DFSSTSVPLG  540
PLEEPRVDLQ GEEGLIGNIV QTINYTQKQR WEEHKQDYNC YLNQTFGSIN SLVSANRNLS  600
PLSQSLDQSN AVCSKQIDAS LIDQLNGTSS AVHSIVVAES AMDTTMKPNE NYSFDPTKLQ  660
DGLIQNSYGS LDDIMNSMME RGQNETAIGD AEFGYDAYSL GSCI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-23211271464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892878.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLM5WH030.0M5WH03_PRUPE; Uncharacterized protein
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-127response regulator 12